DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab3a

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001016426.1 Gene:rab3a / 549180 XenbaseID:XB-GENE-489999 Length:220 Species:Xenopus tropicalis


Alignment Length:191 Identity:97/191 - (50%)
Similarity:138/191 - (72%) Gaps:4/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:||:|:||:|.||||..|||:::|:|...|:||:|||||::||..::|:|||||||||||
 Frog    17 QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQ 81

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:||||.|:||..:::|...|:..:..:.:.:|:||||::.|:|.||
 Frog    82 ERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVS 146

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNP----PKGGHQL 189
            .|||.|||...|.:|.|.|||.:|||::.|..|...|..|..:.::..:|    .|.|.||
 Frog   147 SERGRQLAEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDTADPAVTGAKQGPQL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 91/165 (55%)
rab3aNP_001016426.1 Rab3 22..186 CDD:206657 89/163 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.