DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab10

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_059055.2 Gene:Rab10 / 50993 RGDID:620879 Length:200 Species:Rattus norvegicus


Alignment Length:205 Identity:141/205 - (68%)
Similarity:162/205 - (79%) Gaps:12/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            ||||.||||||||||||||||:|||||:|||||||||||||||||:|:||..|||||||||||||
  Rat     4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQ 68

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            |||.||||:|||||||||||||||..||||||..|:|||:|:|:.|||:|||||||::.|||.|.
  Rat    69 ERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVP 133

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKT---EKRMEANNPPKGGHQLKPMDS 194
            |.:|||:|.|:||:|.||||||:||:|:||||||.||..||   |...|..:...||        
  Rat   134 KGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGG-------- 190

  Fly   195 RTKDSWLSRC 204
             ....|.|:|
  Rat   191 -GVTGWKSKC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 129/165 (78%)
Rab10NP_059055.2 Rab8_Rab10_Rab13_like 7..173 CDD:206659 129/165 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.