DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab1a

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001004787.1 Gene:rab1a / 448007 XenbaseID:XB-GENE-485527 Length:204 Species:Xenopus tropicalis


Alignment Length:199 Identity:110/199 - (55%)
Similarity:147/199 - (73%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |...|||||||||||||||||:|:|.||::|.:..::|||||:||||||||||.|.|||||||||
 Frog     4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||||||::|||||.||::|||:|.::||.|:|.|::.|:..||.:|.|:|:||||:||.|:.
 Frog    69 GQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKV 133

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK---------TEKRMEANNPP--- 183
            |.....::.|...||.|:|||||.:.|||:||:|:|::||.:         .||.::..:.|   
 Frog   134 VDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGQEKNVKIQSTPVKQ 198

  Fly   184 -KGG 186
             .||
 Frog   199 SSGG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 103/165 (62%)
rab1aNP_001004787.1 Rab1_Ypt1 10..175 CDD:206661 102/164 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.