DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab18

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:177 Identity:65/177 - (36%)
Similarity:107/177 - (60%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERF 70
            |...|||:||:|||||:.::.||.|:.|:.....|||:|||.:.:::|....|:.:|||||.|||
  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67

  Fly    71 RTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEE-NASADVEKMLLGNKCELTDKRQVSKE 134
            |::|.::||.|:|.:||||||...|...::.|:..::. :.:.::..:::|||  :.::|.|.:|
  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNK--IDEERVVDRE 130

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN 181
            .|.:.|.::...|:|||||....|.:.|    .|:..|.......||
  Fly   131 EGRKFARKHRALFIETSAKCDQFVSDVF----KDVVEKIVSSEYFNN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 62/166 (37%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 62/165 (38%)
Rab18 6..165 CDD:206656 61/164 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.