DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RabX1

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:162 Identity:62/162 - (38%)
Similarity:96/162 - (59%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLLIGDSGVGKTCILFRFSEDAFN--TTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRT 72
            |:|::|..|||||.::.|:.::..:  .:.:.||.:.|....|.||..||||||||||||||:|.
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71

  Fly    73 ITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGE 137
            :...|||.|...:||:|:||.|:|..||:||:.:..|....:...|:|||.::..:|.||:|...
  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136

  Fly   138 QLAIEYGIKFMETSAKASINVEEAFLTLASDI 169
            ..|...|..:.|||.:....:|:.|::.|..:
  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 62/162 (38%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 61/158 (39%)
Rab 7..166 CDD:206640 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.