DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab1bb

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001002129.2 Gene:rab1bb / 415219 ZFINID:ZDB-GENE-040625-133 Length:201 Species:Danio rerio


Alignment Length:191 Identity:113/191 - (59%)
Similarity:144/191 - (75%) Gaps:7/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |...|||||||||||||||||:|||.||::|.:..:||||||:||||||||||.|.|||||||||
Zfish     1 MNPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFKIRTIELDGKTIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||||||::|||||.||::|||:|.::|:.|:|.|::.|:..||.:|.|:|:||||:||.|:.
Zfish    66 GQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLKEIDRYASENVNKLLVGNKCDLTTKKV 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKP 191
            |.....::.|...||.|:|||||.:.|||:||:|:|.:||    |||   .|...|...||
Zfish   131 VDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIK----KRM---RPGASGGSEKP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 104/165 (63%)
rab1bbNP_001002129.2 Rab1_Ypt1 7..172 CDD:206661 103/168 (61%)
RAB 9..172 CDD:197555 101/166 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.