DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab19

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:210 Identity:94/210 - (44%)
Similarity:139/210 - (66%) Gaps:17/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            :|:|||::||||.|.|||||:.||....:.....:|||:||.::||.::.|:|||||||||||||
  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            |||||.:|||.|.|:::|||||:..||.|::.||..:....:::|..:|:||||:|.::|:|..|
  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147

  Fly   135 RGEQLA--IEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN---PPKGGHQL---KP 191
            ...|:.  |...:..||||||.::|||:||..||:::|    ::.:|||   .|:....|   ||
  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELK----RQHDANNVEEVPENTITLGQGKP 208

  Fly   192 MDSRTKDSWLSRCSL 206
            :.|.:     |.|:|
  Fly   209 LKSCS-----SSCNL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 83/167 (50%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 82/164 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.