DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab13

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_958486.1 Gene:rab13 / 373105 ZFINID:ZDB-GENE-030826-30 Length:200 Species:Danio rerio


Alignment Length:207 Identity:136/207 - (65%)
Similarity:172/207 - (83%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||.||:||||||||||||||||::.||:||.||:|:|||||||||::|||::.||:|||:||||
Zfish     1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||:|||||||||||||:||||||.|||:|||:||:::|:|||||.|.:|||||||::..||:
Zfish    66 GQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIEAKRK 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSR 195
            ||||.||:||.|:||:|.|||||:||||||:|.:||.||..|:.|:     |...|.::|...:.
Zfish   131 VSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDILLKSNKK-----PGPSGREVKLTSTE 190

  Fly   196 TKDSWLSRCSLL 207
            .|.|  |:|.||
Zfish   191 KKSS--SKCLLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 121/165 (73%)
rab13NP_958486.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 121/165 (73%)
RAB 9..170 CDD:197555 118/160 (74%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.