Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007162.1 | Gene: | rab1ab / 368883 | ZFINID: | ZDB-GENE-030616-564 | Length: | 201 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 111/200 - (55%) |
---|---|---|---|
Similarity: | 149/200 - (74%) | Gaps: | 14/200 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
Fly 66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
Fly 131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK---------TEKRMEANNPPKGG 186
Fly 187 HQLKP 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 103/165 (62%) |
rab1ab | NP_001007162.1 | Rab1_Ypt1 | 7..172 | CDD:206661 | 102/164 (62%) |
RAB | 9..172 | CDD:197555 | 100/162 (62%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |