DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab40c

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_872616.1 Gene:Rab40c / 359728 RGDID:727914 Length:281 Species:Rattus norvegicus


Alignment Length:164 Identity:75/164 - (45%)
Similarity:104/164 - (63%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            |:||||.|.||:|||.|||..||....:.|..:.:..:.|||:|..||.||.:::||::|||:||
  Rat     9 KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDTSGQ 73

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            .||.||..:|.|||.||:||||||...||:.|..||:.|:|:|.. |.::|:||:..|..||||.
  Rat    74 GRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPG-VPRILVGNRLHLAFKRQVP 137

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLA 166
            .|:....|.:..:.|.|.|...:.||.|:|..|:
  Rat   138 TEQARAYAEKNCMTFFEVSPLCNFNVIESFTELS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 73/161 (45%)
Rab40cNP_872616.1 Rab40 9..281 CDD:133321 75/164 (46%)
SOCS_Rab40 187..229 CDD:239711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.