DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab32

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:215 Identity:67/215 - (31%)
Similarity:121/215 - (56%) Gaps:12/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYD---YLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELD-NKKIKLQI 61
            |..|.|   :|:|:|:||:.|.|||..:.|:....|:..:.:|||:||.::.::.| |..::||:
  Fly   473 MTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQL 537

  Fly    62 WDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENA----SADVEKMLLGNK 122
            ||.||||||..:|..||:.|:|..:|:|:|:..:|:.:..|..:::...    .:.:..:||.||
  Fly   538 WDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANK 602

  Fly   123 CELTDKRQVSK-ERGEQLAIEYGIK-FMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKG 185
            |:...:..::: |:.::...|.|.. :.|||||.:||::||...|.:.|.. .:|.:.|:.....
  Fly   603 CDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILI-NDKLISADLADGD 666

  Fly   186 GHQLKPMDSRTKDSWLSRCS 205
            ...|...|:...|: .::||
  Fly   667 KFNLSAADATGSDA-KNKCS 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 58/175 (33%)
Rab32NP_525109.1 PHA03247 <126..481 CDD:223021 3/7 (43%)
Rab32_Rab38 484..686 CDD:206692 63/204 (31%)

Return to query results.
Submit another query.