DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab9

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:161 Identity:60/161 - (37%)
Similarity:95/161 - (59%) Gaps:5/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRT 72
            |.|::::||.||||:.:|.||..:.:......|||::|..:.|.:|.::..|||||||||||||.
  Fly    12 LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRA 76

  Fly    73 ITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEK---MLLGNKCEL-TDKRQVSK 133
            :.|.:|||:...:|.|.:....|.:.:..|.......|..|.:|   :::|||.:: ..|||||.
  Fly    77 LRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVSS 141

  Fly   134 ERGEQLAIEYGIK-FMETSAKASINVEEAFL 163
            :..:|...|..:. .:|||:||:.||.:||:
  Fly   142 DAVQQWCAEQKVACHIETSSKAATNVTDAFV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 60/161 (37%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 60/161 (37%)
Ras 14..177 CDD:278499 59/159 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.