DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab10

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster


Alignment Length:179 Identity:136/179 - (75%)
Similarity:155/179 - (86%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            ||||.||||||||||||||||||||||:|||.:||||||||||||:|:||..|||||||||||||
  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            |||.||||:|||||||||||||||.|||||||..|:|||:|:|:.|||||:|||||::||||.|:
  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN 181
            |||||.:|.|:||:|||||||::||:|.||..||..|..||..|..|.|
  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAEN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 128/165 (78%)
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 128/165 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454316
Domainoid 1 1.000 239 1.000 Domainoid score I589
eggNOG 1 0.900 - - E1_KOG0078
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 250 1.000 Inparanoid score I1031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114050at6656
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm3278
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
1110.930

Return to query results.
Submit another query.