DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab40

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:176 Identity:74/176 - (42%)
Similarity:105/176 - (59%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGID----------FKIRTIELDNK 55
            |.|.||||.|:||:|||.|||..||....:.:..:.|.|  |.|          :|..||.|:.|
  Fly     4 MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGK 66

  Fly    56 KIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLG 120
            ::|||:|||:||.||.||..:|.|||.||:||||||.:.||:.|..|::.::|:|.. :.|:|:|
  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVG 130

  Fly   121 NKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLA 166
            |:..|..||||:.::.|..|....:...|.|...:.|:.|:|..||
  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 71/171 (42%)
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 73/174 (42%)
RAB 12..182 CDD:197555 68/168 (40%)
SOCS 192..234 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.