DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rasef

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001264263.1 Gene:Rasef / 298138 RGDID:1306418 Length:709 Species:Rattus norvegicus


Alignment Length:210 Identity:82/210 - (39%)
Similarity:124/210 - (59%) Gaps:12/210 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            :..|....:|::|.||:.|||:..|.|..::.|.....:|:|:||:::|:.:|.:...||:||||
  Rat   503 LKSTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLMVDGEPTVLQLWDTA 567

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTD--- 127
            ||||||:|..:|:|.|.|::|:||:|.||||.|::.|:..:|:.....|..||:|||.:|.|   
  Rat   568 GQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVAMVEDGTHRSVPIMLVGNKADLRDAAT 632

  Fly   128 ---KRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQL 189
               ::.:|...||:||:.||..|.|||||...||.||.|.||.::|.:.|     |:..|....|
  Rat   633 AENQKCISSHLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKRAE-----NDDSKSITSL 692

  Fly   190 KPMDSRTKDSWLSRC 204
            ....|| |...:..|
  Rat   693 ATSTSR-KSLQMKNC 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 73/171 (43%)
RasefNP_001264263.1 FRQ1 <1..73 CDD:444056
SMC_prok_B <141..>321 CDD:274008
Rab 511..675 CDD:206640 71/163 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.