DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab35

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001013064.1 Gene:Rab35 / 288700 RGDID:1306362 Length:201 Species:Rattus norvegicus


Alignment Length:185 Identity:91/185 - (49%)
Similarity:134/185 - (72%) Gaps:8/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            ||:.||:|||||:||||||||:.:|.||:::.|:.::|:|||:||||||:|::.:|:||||||||
  Rat     1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||||||:.||||..|:::|||:|..:||.|:|.|:..|.:|.. ||.::|:|||.:..:::.
  Rat    66 GQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKV 129

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAF-------LTLASDIKAKTEKRME 178
            |..|...:.|.:.||:..|||||.::||||.|       |....|..||.:::.:
  Rat   130 VETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 86/172 (50%)
Rab35NP_001013064.1 Rab35 3..201 CDD:133310 89/183 (49%)
Effector region. /evidence=ECO:0000250 37..45 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.