DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab8b

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_038936858.1 Gene:Rab8b / 266688 RGDID:628764 Length:208 Species:Rattus norvegicus


Alignment Length:208 Identity:164/208 - (78%)
Similarity:183/208 - (87%) Gaps:1/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||||||||||||||||||||||:|||||||||||||||||||||||||||||.|||||||||||
  Rat     1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAM-GIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKR 129
            ||||||||||||||||| |||||||||.||||:|||||||||||:||:|||:|:|||||::.|||
  Rat    66 GQERFRTITTAYYRGAMQGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKR 130

  Fly   130 QVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDS 194
            ||||||||:|||:|||||:|||||:|.||||||.|||.||..|..::|..:|....|..:|..:|
  Rat   131 QVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITES 195

  Fly   195 RTKDSWLSRCSLL 207
            |:|.:...|||||
  Rat   196 RSKKTSFFRCSLL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 146/166 (88%)
Rab8bXP_038936858.1 Rab8_Rab10_Rab13_like 6..173 CDD:206659 146/166 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353635
Domainoid 1 1.000 291 1.000 Domainoid score I1478
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 335 1.000 Inparanoid score I2323
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm44767
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.