DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab12

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_037149.1 Gene:Rab12 / 25530 RGDID:3527 Length:243 Species:Rattus norvegicus


Alignment Length:168 Identity:83/168 - (49%)
Similarity:125/168 - (74%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERF 70
            |:..::::||..|||||.::.||::|.|.....||:|:||||:|:||..|||:||||||||||||
  Rat    39 DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERF 103

  Fly    71 RTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKER 135
            .:||:||||.|.||:||||||::::|:::..|::.|::.||.|.|.:|:|||.:....|::|:::
  Rat   104 NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQ 168

  Fly   136 GEQLAIEY-GIKFMETSAKASINVEEAFLTLASDIKAK 172
            ||:.|.:. |::|.|.|||.:.||:|.||.|..||..|
  Rat   169 GEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 82/166 (49%)
Rab12NP_037149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Rab12 42..243 CDD:206699 82/165 (50%)
Effector region. /evidence=ECO:0000250 70..78 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.