DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and ypt2

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:126/207 - (60%)
Similarity:159/207 - (76%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            |:||||.||||||||||||:|:|.|||||:|..:||:||||||||||||||.|:|||||||||||
pombe     4 KSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQ 68

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            |||||||||||||||||:|:||:|.:|||:|::.|..|:|::||.:|.|:|:||||:..|:||||
pombe    69 ERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQRQVS 133

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIK-----AKTEKRMEANNPPKGGHQLKPM 192
            .|:|:.||.|.|:||:|.|||.::||:|||.|||.:||     |:.|...:|||...|       
pombe   134 FEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNVDLG------- 191

  Fly   193 DSRTKDSWLSRC 204
                .|..:.||
pombe   192 ----NDRTVKRC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 115/170 (68%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 115/165 (70%)
Ras 11..172 CDD:278499 111/160 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 240 1.000 Domainoid score I454
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 253 1.000 Inparanoid score I767
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm47008
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.