DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab12

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_077768.3 Gene:Rab12 / 19328 MGIID:894284 Length:291 Species:Mus musculus


Alignment Length:168 Identity:83/168 - (49%)
Similarity:125/168 - (74%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERF 70
            |:..::::||..|||||.::.||::|.|.....||:|:||||:|:||..|||:||||||||||||
Mouse    87 DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERF 151

  Fly    71 RTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKER 135
            .:||:||||.|.||:||||||::::|:::..|::.|::.||.|.|.:|:|||.:....|::|:::
Mouse   152 NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQ 216

  Fly   136 GEQLAIEY-GIKFMETSAKASINVEEAFLTLASDIKAK 172
            ||:.|.:. |::|.|.|||.:.||:|.||.|..||..|
Mouse   217 GEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 82/166 (49%)
Rab12NP_077768.3 Rab12 90..291 CDD:206699 82/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.