DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and 4R79.2

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001255966.1 Gene:4R79.2 / 181797 WormBaseID:WBGene00007067 Length:395 Species:Caenorhabditis elegans


Alignment Length:177 Identity:69/177 - (38%)
Similarity:110/177 - (62%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIEL-DNKKIKLQIWDTAGQER 69
            |.:||::.:|||.|||||.|.||..:.|...|.:|||:||.::|::: .|:.|.:|:||||||||
 Worm   200 DRIFKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQER 264

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK---RQV 131
            ||:||..|:|.|.|::|::|:|.|:||.|::|||.::...........|:|||.:|...   |..
 Worm   265 FRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSA 329

  Fly   132 SKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME 178
            .....|:||:|:.|.|.||||.....::.....:|.:::.:.:..:|
 Worm   330 VYRAAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 68/169 (40%)
4R79.2NP_001255966.1 RAB 203..370 CDD:197555 67/166 (40%)
Rab 203..365 CDD:206640 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.