DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rsef-1

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001359915.1 Gene:rsef-1 / 180593 WormBaseID:WBGene00016344 Length:634 Species:Caenorhabditis elegans


Alignment Length:187 Identity:67/187 - (35%)
Similarity:111/187 - (59%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTI 73
            |::::.||:.|||:..:.|.....|.....||:|:||.::|:.:|.:.:.||:||||||||||::
 Worm   440 FRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRSL 504

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCE--LTDKRQVSKERG 136
            ..:|:|.|.|.:||||:..|:||..:::||..|:|:....:..:|:|||.:  ::....|:|..|
 Worm   505 CKSYFRRADGAILVYDVCAEQSFLRVRDWIETIKESTERSIPIILVGNKVDMRISTPGSVAKTDG 569

  Fly   137 EQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEAN----NP---PKGG 186
            ..:|...|:.||||||....|::.|.|.|..::.|..:..:.:.    ||   .|||
 Worm   570 ASMAAAMGVLFMETSALDGSNIDNAMLALTRELMAVEDVEIRSTGVVLNPAVAKKGG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 61/164 (37%)
rsef-1NP_001359915.1 EF-hand_7 3..63 CDD:372618
Smc <155..>362 CDD:224117
Rab 440..600 CDD:206640 61/159 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.