DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab-35

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_499454.1 Gene:rab-35 / 176560 WormBaseID:WBGene00004284 Length:209 Species:Caenorhabditis elegans


Alignment Length:209 Identity:98/209 - (46%)
Similarity:136/209 - (65%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKT--YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWD 63
            ||.|  ||:|||||:||||||||:.:|.||:::.|:..:|:|||:||||||::::.:::||||||
 Worm     1 MAGTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWD 65

  Fly    64 TAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK 128
            |||||||||||:.||||..|:::|||:|..:||.|:|.|::.||.|..: |:|:|:|||||..::
 Worm    66 TAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDS-VQKVLVGNKCEENER 129

  Fly   129 RQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLAS-DIKAKTEKRMEANNPPK--GGHQLK 190
            |.|.:......|....|.|.|||||...|||..|..:.| .:.||......|:....  ||..||
 Worm   130 RVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQSRTGGVSLK 194

  Fly   191 PMDSRTKDSWLSRC 204
            .....|......:|
 Worm   195 DNSGSTNQKKKCKC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 85/166 (51%)
rab-35NP_499454.1 Rab35 5..208 CDD:133310 94/203 (46%)
RAB 11..171 CDD:197555 83/160 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.