Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497608.1 | Gene: | Y71H2AM.12 / 175389 | WormBaseID: | WBGene00022177 | Length: | 195 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 72/201 - (35%) |
---|---|---|---|
Similarity: | 118/201 - (58%) | Gaps: | 23/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIEL-DNKKIKLQIWDTAGQERFRTI 73
Fly 74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138
Fly 139 LAI---EYGIKFMETSAKASINVEEAFLTLASD--IKAKTEKRMEANNPPKGGHQLKPMDSRTKD 198
Fly 199 SWLSRC 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 63/167 (38%) |
Y71H2AM.12 | NP_497608.1 | Ras | 13..163 | CDD:278499 | 61/154 (40%) |
Rab | 13..163 | CDD:206640 | 61/154 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |