DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Y71H2AM.12

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_497608.1 Gene:Y71H2AM.12 / 175389 WormBaseID:WBGene00022177 Length:195 Species:Caenorhabditis elegans


Alignment Length:201 Identity:72/201 - (35%)
Similarity:118/201 - (58%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIEL-DNKKIKLQIWDTAGQERFRTI 73
            |::::|:||.|||.:|..|.::.|.|..::|||||||.:.::| |.:.|:||:||||||||||.:
 Worm     8 KVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQLWDTAGQERFRQL 72

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138
            ..||.|.|...:||.|::.|...|::..|...|::|.|.....:::|||.:|     ||::|..:
 Worm    73 APAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGNKHDL-----VSEKRSPR 132

  Fly   139 LAI---EYGIKFMETSAKASINVEEAFLTLASD--IKAKTEKRMEANNPPKGGHQLKPMDSRTKD 198
            |..   |...:::|||||...|:::.|.::|..  .:.:|.:.:..|.|       :|::|.|| 
 Worm   133 LTAIIRETNDEYIETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNEP-------RPVESATK- 189

  Fly   199 SWLSRC 204
                ||
 Worm   190 ----RC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 63/167 (38%)
Y71H2AM.12NP_497608.1 Ras 13..163 CDD:278499 61/154 (40%)
Rab 13..163 CDD:206640 61/154 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.