DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab8a

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_075615.2 Gene:Rab8a / 17274 MGIID:96960 Length:207 Species:Mus musculus


Alignment Length:207 Identity:165/207 - (79%)
Similarity:185/207 - (89%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||||||||||||||||||||||:||||||||||:||||||||||||||||||.|:|||||||||
Mouse     1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            ||||||||||||||||||||||||||.||||:||:||||||||:||||||||:|||||::.||||
Mouse    66 GQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQ 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSR 195
            |||||||:||::||||||||||||:||||.||.|||.|||||.:|::|.|:|....|.:|....:
Mouse   131 VSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQ 195

  Fly   196 TKDSWLSRCSLL 207
            .|.:...|||||
Mouse   196 QKRTSFFRCSLL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 146/165 (88%)
Rab8aNP_075615.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 146/165 (88%)
Effector region. /evidence=ECO:0000250 37..45 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 291 1.000 Domainoid score I1531
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 335 1.000 Inparanoid score I2390
Isobase 1 0.950 - 0 Normalized mean entropy S199
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm42702
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.