DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab3c

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_598220.1 Gene:Rab3c / 171058 RGDID:620923 Length:227 Species:Rattus norvegicus


Alignment Length:197 Identity:96/197 - (48%)
Similarity:140/197 - (71%) Gaps:4/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:||||:||:|.||||..|||:::|:|.:.|:||:|||||::|:..:.|:|||||||||||
  Rat    25 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQ 89

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:||||.|:||..:::|...|:..:..:.:.:|:||||::.|:|.||
  Rat    90 ERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVS 154

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTK 197
            .|||..|..:.|.:|.|||||.:|||::.|..|...|..|..:.:|.:....|..|    .:|.|
  Rat   155 TERGRHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITGAKQ----STRLK 215

  Fly   198 DS 199
            ::
  Rat   216 ET 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 90/165 (55%)
Rab3cNP_598220.1 Rab3 30..194 CDD:206657 88/163 (54%)
RAB 31..191 CDD:197555 87/159 (55%)
Effector region. /evidence=ECO:0000250 59..67 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.