DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RASEF

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_689786.2 Gene:RASEF / 158158 HGNCID:26464 Length:740 Species:Homo sapiens


Alignment Length:173 Identity:75/173 - (43%)
Similarity:115/173 - (66%) Gaps:6/173 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTI 73
            :|::|.||:.|||:..|.|..::.|.....:|:|:||:::|:.:|.::..||:||||||||||:|
Human   542 YKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSI 606

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKER--- 135
            ..:|:|.|.|::|:||:|.||||.||:.|:..||:.|...|..||:|||.::.|......::   
Human   607 AKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVP 671

  Fly   136 ---GEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEK 175
               ||:||:.||..|.|||||...|:.||.|.||.::|.:|:|
Human   672 GHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDK 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 73/168 (43%)
RASEFNP_689786.2 EFh 12..71 CDD:238008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..110
SMC_N <174..>351 CDD:330553
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..403
Rab 542..706 CDD:206640 71/163 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..740 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.