DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB40A

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_543155.2 Gene:RAB40A / 142684 HGNCID:18283 Length:277 Species:Homo sapiens


Alignment Length:203 Identity:78/203 - (38%)
Similarity:113/203 - (55%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.||:|.|.||:||..|||:.||....:.|..:.:....|||:|..||.||.:::||::|||:||
Human     9 QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLWDTSGQ 73

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            .||.||..:|.|||.|::|||||....|||.:..||:.|||:|.. |.|:|:||:..|..||||.
Human    74 GRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVP 137

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTK 197
            :|:.:..|...|:.|.|.|...:.|:.|:|..||..:..:              |::        
Human   138 REQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLR--------------HRM-------- 180

  Fly   198 DSWLSRCS 205
             :||.|.|
Human   181 -NWLGRPS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 72/165 (44%)
RAB40ANP_543155.2 P-loop_NTPase 9..277 CDD:328724 78/203 (38%)
SOCS_Rab40 187..228 CDD:239711 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.