Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_543155.2 | Gene: | RAB40A / 142684 | HGNCID: | 18283 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 78/203 - (38%) |
---|---|---|---|
Similarity: | 113/203 - (55%) | Gaps: | 24/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
Fly 68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
Fly 133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTK 197
Fly 198 DSWLSRCS 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 72/165 (44%) |
RAB40A | NP_543155.2 | P-loop_NTPase | 9..277 | CDD:328724 | 78/203 (38%) |
SOCS_Rab40 | 187..228 | CDD:239711 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |