DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB10

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_057215.3 Gene:RAB10 / 10890 HGNCID:9759 Length:200 Species:Homo sapiens


Alignment Length:205 Identity:141/205 - (68%)
Similarity:162/205 - (79%) Gaps:12/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            ||||.||||||||||||||||:|||||:|||||||||||||||||:|:||..|||||||||||||
Human     4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQ 68

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            |||.||||:|||||||||||||||..||||||..|:|||:|:|:.|||:|||||||::.|||.|.
Human    69 ERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVP 133

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKT---EKRMEANNPPKGGHQLKPMDS 194
            |.:|||:|.|:||:|.||||||:||:|:||||||.||..||   |...|..:...||        
Human   134 KGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGG-------- 190

  Fly   195 RTKDSWLSRC 204
             ....|.|:|
Human   191 -GVTGWKSKC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 129/165 (78%)
RAB10NP_057215.3 Rab8_Rab10_Rab13_like 7..173 CDD:206659 129/165 (78%)
Effector region. /evidence=ECO:0000250 38..46 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.