DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and LOC100535415

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_021326418.1 Gene:LOC100535415 / 100535415 -ID:- Length:731 Species:Danio rerio


Alignment Length:202 Identity:129/202 - (63%)
Similarity:166/202 - (82%) Gaps:0/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERF 70
            |.|||::|:|:|.||||.:|.||.:|.|::...:|:|||:.::|:.:||.:|.||:|||||||||
Zfish   530 DRLFKVVLVGNSSVGKTSLLRRFCDDCFHSGTCATVGIDYSVKTLSVDNSQIALQMWDTAGQERF 594

  Fly    71 RTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKER 135
            |||||||||||||||||||||.||||||||||||||||:||:|||||:|||||::.::|||||||
Zfish   595 RTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVEKMILGNKCDMNERRQVSKER 659

  Fly   136 GEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSW 200
            ||:|||:|||||:|||||.||||||||.|||.||.|:..::|...:...||..:|..:.|:|...
Zfish   660 GEKLAIDYGIKFLETSAKTSINVEEAFFTLARDIMARLNRKMNDGSQADGGGPVKISEKRSKKHS 724

  Fly   201 LSRCSLL 207
            :.:|:||
Zfish   725 IFKCALL 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 119/165 (72%)
LOC100535415XP_021326418.1 EF-hand_7 35..97 CDD:316058
SMC_N <162..>371 CDD:330553
Rab8_Rab10_Rab13_like 530..696 CDD:206659 119/165 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.