DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and XB5802730

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001107281.1 Gene:XB5802730 / 100135070 XenbaseID:XB-GENE-5802731 Length:201 Species:Xenopus tropicalis


Alignment Length:196 Identity:102/196 - (52%)
Similarity:139/196 - (70%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTIT 74
            ||::.|||.|||||||.||:|:.. .::|||:|||||.:||.:....:|||||||||||||.|::
 Frog    14 KLVMTGDSDVGKTCILTRFTENTL-PSYISTVGIDFKTKTIHVAETALKLQIWDTAGQERFHTLS 77

  Fly    75 TAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQL 139
            .:|:|||.|.:||||||...||||...|:|:|:..|..:||.:||||||:..|:|:|:||:||:|
 Frog    78 VSYFRGAQGFVLVYDITNPASFENTAVWMRDIKMKAGEEVEVVLLGNKCDREDEREVAKEQGEKL 142

  Fly   140 AIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSWLSRC 204
            |.|:||.|.|||||.:||:|:||:|||..|.||....:..:|      .:...|.:.|:|.|: |
 Frog   143 AWEFGIPFFETSAKENINIEKAFITLAEAIYAKRGSLLVNHN------VVNLQDMKKKNSCLT-C 200

  Fly   205 S 205
            |
 Frog   201 S 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 93/161 (58%)
XB5802730NP_001107281.1 RAB 13..175 CDD:197555 93/161 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.