DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab8a

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_002934841.1 Gene:rab8a / 100125217 XenbaseID:XB-GENE-1018135 Length:207 Species:Xenopus tropicalis


Alignment Length:207 Identity:165/207 - (79%)
Similarity:183/207 - (88%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||||||||||||||||||||||:||||||||||:||||||||||||||||||.|:|||||||||
 Frog     1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            ||||||||||||||||||||||||||.||||:|||||||||||:||:|||||:|||||::.:|||
 Frog    66 GQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDVNEKRQ 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSR 195
            ||||:||:||:|||||||||||||:||||.||.|||.|||||.:||||.|:|......:|....:
 Frog   131 VSKEKGEKLALEYGIKFMETSAKANINVENAFFTLARDIKAKMDKRMEGNSPQGSNQGVKITQDQ 195

  Fly   196 TKDSWLSRCSLL 207
            .|.|...||.||
 Frog   196 QKKSSFFRCVLL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 145/165 (88%)
rab8aXP_002934841.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 145/165 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 290 1.000 Domainoid score I1518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 333 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm47805
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.