DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and MET14

DIOPT Version :9

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_012925.3 Gene:MET14 / 853869 SGDID:S000001484 Length:202 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:112/207 - (54%)
Similarity:141/207 - (68%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDG 110
            :|||:|...:....|.:.     .|...|||:||||||.:||::||..||..|:.:.:.||.|||
Yeast     1 MATNITWHPNLTYDERKA-----LRKQDGCTIWLTGLSASGKSTIACALEQLLLQKNLSAYRLDG 60

  Fly   111 DNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKF 175
            ||||.||||:|||:..||.|||||:.||:||||||..::|.||:||:..||:.||::||:|||||
Yeast    61 DNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCAISITSFISPYRVDRDRARELHKEAGLKF 125

  Fly   176 YEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVT 240
            .|||||.||:|.|.||.|||||||||||||.||||:..||.|:.|||.:.|...||.|....:..
Yeast   126 IEIFVDVPLEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPKAPELHLRTDQKTVEECATIIYE 190

  Fly   241 LLEQEGIIPRSL 252
            .|..|.||.:.|
Yeast   191 YLISEKIIRKHL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 APS_kinase 73..228 CDD:279865 98/154 (64%)
sopT 270..648 CDD:273023
ATPS 279..650 CDD:173895
MET14NP_012925.3 apsK 7..192 CDD:129547 103/189 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345344
Domainoid 1 1.000 203 1.000 Domainoid score I545
eggNOG 1 0.900 - - E1_COG0529
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81740
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S866
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000913
OrthoInspector 1 1.000 - - oto99990
orthoMCL 1 0.900 - - OOG6_100343
Panther 1 1.100 - - LDO PTHR11055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R633
SonicParanoid 1 1.000 - - X525
TreeFam 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.