DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and AKN2

DIOPT Version :9

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_195704.1 Gene:AKN2 / 830153 AraportID:AT4G39940 Length:293 Species:Arabidopsis thaliana


Alignment Length:260 Identity:104/260 - (40%)
Similarity:139/260 - (53%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LPSVEKPEDACLQV----------ATNVTEQ----------KHHVTRETRGKNLG---------- 67
            ||:...|.|:...|          |.||:.|          ...:.:|  |:|.|          
plant    36 LPASSIPADSRKLVANSTSFHPISAVNVSAQASLTADFPALSETILKE--GRNNGKEKAENIVWH 98

  Fly    68 ---LCRGFR-------GCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLG 122
               :||..|       ||.||:|||||:||:::|..|...|..||...|.|||||:|.|||::|.
plant    99 ESSICRCDRQQLLQQKGCVVWITGLSGSGKSTVACALSKALFERGKLTYTLDGDNVRHGLNRDLT 163

  Fly   123 FTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVC 187
            |....|.|||||:|||||||||.||:.|.|.:||:..||:..|.:..|.  .|.|:|:|.||.||
plant   164 FKAEHRTENIRRIGEVAKLFADVGVICIASLISPYRRDRDACRSLLPDG--DFVEVFMDVPLHVC 226

  Fly   188 ETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHG----YTVRESTQKLVTLLEQEGII 248
            |:||.|||||.||.|.|||||||...||.|...|:|:...|    .:.|:..:.:::.|:.:|.:
plant   227 ESRDPKGLYKLARAGKIKGFTGIDDPYEAPVNCEVVLKHTGDDESCSPRQMAENIISYLQNKGYL 291

  Fly   249  248
            plant   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 APS_kinase 73..228 CDD:279865 85/161 (53%)
sopT 270..648 CDD:273023
ATPS 279..650 CDD:173895
AKN2NP_195704.1 CysC 93..293 CDD:223603 91/201 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I1175
eggNOG 1 0.900 - - E1_COG0529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000913
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100343
Panther 1 1.100 - - O PTHR11055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X525
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.