DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and APS3

DIOPT Version :9

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001329676.1 Gene:APS3 / 827118 AraportID:AT4G14680 Length:510 Species:Arabidopsis thaliana


Alignment Length:419 Identity:223/419 - (53%)
Similarity:290/419 - (69%) Gaps:16/419 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 ITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGII-PRSLRDVDL-LPELYPSESIATEAL 272
            |:|...:....:.|..:..:.....|:.|.|:..:.|:| |...:.||| :||....|.      
plant    15 ISQPLTKSHKSDSVTTSISFPSNSKTRSLRTISVRAGLIEPDGGKLVDLVVPEPRRREK------ 73

  Fly   273 RHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPI 337
            :|||..|..:.::.::|||:.||:||||.||||||||.|:|||||||.|... |||. .|.||||
plant    74 KHEAADLPRVRLTAIDLQWMHVLSEGWASPLRGFMRESEFLQTLHFNLLNLD-DGSV-VNMSVPI 136

  Fly   338 VLSATQADKDRLDGCSSLTL-KYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQ-VYE 400
            ||:.....|..:.....::| ......:|||...|.|...||||:||.:||:.|..||.:: :..
plant   137 VLAIDDQQKALIGESKRVSLVDSDDNPIAILNDIEIYKHPKEERIARTWGTTAPGLPYVEEAITN 201

  Fly   401 SGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTR 465
            :||:|:||||.|:|.:::.||||::||:|.|||:..::..|||:||||||||:||||||||.|||
plant   202 AGDWLIGGDLEVLEPVKYNDGLDRFRLSPFELRKELEKRGADAVFAFQLRNPVHNGHALLMTDTR 266

  Fly   466 RQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPT 530
            |:|||.|:|.|:||||||||:||.|||||..|||||:.||:.|||..|.||::||||||:|||||
plant   267 RRLLEMGYKNPILLLHPLGGFTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMLYAGPT 331

  Fly   531 EVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRV 595
            |||||||||:||||||||||||||||.||.::.    :||||.||.:||.||.||:.:.||||||
plant   332 EVQWHAKARINAGANFYIVGRDPAGMGHPVEKR----DLYDADHGKKVLSMAPGLERLNILPFRV 392

  Fly   596 AAYDKSASRMAFFEPKRKDEFEFISGTKM 624
            |||||:..:||||:|.|..:|.||||||:
plant   393 AAYDKTQGKMAFFDPSRAQDFLFISGTKV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 APS_kinase 73..228 CDD:279865 3/17 (18%)
sopT 270..648 CDD:273023 208/357 (58%)
ATPS 279..650 CDD:173895 205/348 (59%)
APS3NP_001329676.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 322 1.000 Domainoid score I273
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 460 1.000 Inparanoid score I369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D528280at2759
OrthoFinder 1 1.000 - - FOG0000913
OrthoInspector 1 1.000 - - otm3262
orthoMCL 1 0.900 - - OOG6_100343
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.