DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and APS1

DIOPT Version :9

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_188929.1 Gene:APS1 / 821861 AraportID:AT3G22890 Length:463 Species:Arabidopsis thaliana


Alignment Length:399 Identity:235/399 - (58%)
Similarity:295/399 - (73%) Gaps:9/399 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 LPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQ 322
            |.||...|....|. :|||..|..:|::.::|||:.||:||||.||.|||||.|:|||||||:|:
plant    58 LVELIVEEPKRREK-KHEAADLPRVELTAIDLQWMHVLSEGWASPLGGFMRESEFLQTLHFNSLR 121

  Fly   323 SGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTL-KYQGKAVAILRRPEFYFQRKEERLARQFG 386
            .. |||. .|.||||||:.....|.|:...:.:.| ...|..||||...|.|...||||:||.:|
plant   122 LD-DGSV-VNMSVPIVLAIDDEQKARIGESTRVALFNSDGNPVAILSDIEIYKHPKEERIARTWG 184

  Fly   387 TSNPNHPY-SKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLR 450
            |:.|..|| .:.:..:|::|:||||.|:|.:::.||||::||:|.|||:..::.||||:||||||
plant   185 TTAPGLPYVDEAITNAGNWLIGGDLEVLEPVKYNDGLDRFRLSPAELRKELEKRNADAVFAFQLR 249

  Fly   451 NPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDT 515
            ||:||||||||.||||:|||.|:|.|:||||||||:||.||||||.|||||:.||:.|||..|.|
plant   250 NPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGFTKADDVPLDWRMKQHEKVLEDGVLDPETT 314

  Fly   516 VLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLK 580
            |::||||||.||||||||||||||:||||||||||||||||.||.::.    :||||.||.:||.
plant   315 VVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKR----DLYDADHGKKVLS 375

  Fly   581 MAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWR 645
            ||.||:.:.|||||||||||:..:||||:|.|..:|.||||||||||||...:||||||.|..|:
plant   376 MAPGLERLNILPFRVAAYDKTQGKMAFFDPSRPQDFLFISGTKMRTLAKNNENPPDGFMCPGGWK 440

  Fly   646 ILATYYQNL 654
            :|..||::|
plant   441 VLVDYYESL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 APS_kinase 73..228 CDD:279865
sopT 270..648 CDD:273023 227/379 (60%)
ATPS 279..650 CDD:173895 224/372 (60%)
APS1NP_188929.1 sopT 53..444 CDD:273023 232/392 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 322 1.000 Domainoid score I273
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 460 1.000 Inparanoid score I369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D528280at2759
OrthoFinder 1 1.000 - - FOG0000913
OrthoInspector 1 1.000 - - otm3262
orthoMCL 1 0.900 - - OOG6_100343
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.