DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and APK3

DIOPT Version :10

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001319463.1 Gene:APK3 / 821077 AraportID:AT3G03900 Length:208 Species:Arabidopsis thaliana


Alignment Length:210 Identity:92/210 - (43%)
Similarity:132/210 - (62%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGD 111
            :||:..|:..:.:..|.|.|..    :||.||:|||||:||:::|..|...|.:||..:|.||||
plant     7 STNIFWQESPIGKTERQKLLNQ----KGCVVWITGLSGSGKSTLACSLSRELNNRGKLSYILDGD 67

  Fly   112 NIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFY 176
            |:|.||||:|||...||.|||||||||||||||:|::.|.|.:||:..||:..|::.:::  .|.
plant    68 NLRHGLNKDLGFKAEDRVENIRRVGEVAKLFADAGLICIASLISPYRKDRDACREMIQNS--SFI 130

  Fly   177 EIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRES------- 234
            |:|::..|.:||.||.|||||.||.|.|||||||...||.|...|:.:..     :|.       
plant   131 EVFMNMSLQLCEARDPKGLYKLARAGKIKGFTGIDDPYESPLNCEIELKE-----KEGECPSPVA 190

  Fly   235 -TQKLVTLLEQEGII 248
             .:::::.||.:|.:
plant   191 MAEEVISYLEDKGFL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 CysC 55..249 CDD:440295 89/202 (44%)
ATPS 279..650 CDD:173895
APK3NP_001319463.1 CysC 15..205 CDD:440295 89/200 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.