DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papss and APK3

DIOPT Version :9

Sequence 1:NP_730460.1 Gene:Papss / 40167 FlyBaseID:FBgn0020389 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001319463.1 Gene:APK3 / 821077 AraportID:AT3G03900 Length:208 Species:Arabidopsis thaliana


Alignment Length:210 Identity:92/210 - (43%)
Similarity:132/210 - (62%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGD 111
            :||:..|:..:.:..|.|.|..    :||.||:|||||:||:::|..|...|.:||..:|.||||
plant     7 STNIFWQESPIGKTERQKLLNQ----KGCVVWITGLSGSGKSTLACSLSRELNNRGKLSYILDGD 67

  Fly   112 NIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFY 176
            |:|.||||:|||...||.|||||||||||||||:|::.|.|.:||:..||:..|::.:::  .|.
plant    68 NLRHGLNKDLGFKAEDRVENIRRVGEVAKLFADAGLICIASLISPYRKDRDACREMIQNS--SFI 130

  Fly   177 EIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRES------- 234
            |:|::..|.:||.||.|||||.||.|.|||||||...||.|...|:.:..     :|.       
plant   131 EVFMNMSLQLCEARDPKGLYKLARAGKIKGFTGIDDPYESPLNCEIELKE-----KEGECPSPVA 190

  Fly   235 -TQKLVTLLEQEGII 248
             .:::::.||.:|.:
plant   191 MAEEVISYLEDKGFL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PapssNP_730460.1 APS_kinase 73..228 CDD:279865 82/154 (53%)
sopT 270..648 CDD:273023
ATPS 279..650 CDD:173895
APK3NP_001319463.1 CysC 8..206 CDD:223603 92/209 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I1175
eggNOG 1 0.900 - - E1_COG0529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000913
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100343
Panther 1 1.100 - - O PTHR11055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.