DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and RIM15

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_116620.1 Gene:RIM15 / 850511 SGDID:S000001861 Length:1770 Species:Saccharomyces cerevisiae


Alignment Length:501 Identity:133/501 - (26%)
Similarity:222/501 - (44%) Gaps:175/501 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDV-LVEADHQWV 153
            ::|::.||.|.:||:|.|.|.:||.||..:|:|||||:||:.|.||.:|::||.: :|::|..:|
Yeast   791 IKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKPYV 855

  Fly   154 VKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIK 218
            .:::.|||:..||:|:||:|||||:.||:.....|.::..:.|::|..:.::.:|:.|.||.|:|
Yeast   856 ARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDMHQNGIIHHDLK 920

  Fly   219 PDNLLLDARGHLKLSDFGLC-TGLKKSHR------------------------------------ 246
            |:|||:|..||:||:||||. .||.:.|:                                    
Yeast   921 PENLLIDNAGHVKLTDFGLSRAGLIRRHKFVPHKSSLSISSTLPIDNPANNFTMNNNNSNHSQLS 985

  Fly   247 -----TDFYRDLSQAKP---------SDFIGTCASLSCSPMDS------------KRRAE----- 280
                 |..::..:::|.         |::..|..|.|.:|..|            |.|:.     
Yeast   986 TPDSFTSDHKQYNRSKKSSLGQQYEHSEYSSTSNSHSMTPTPSTNTVVYPSYYRGKDRSHGSSNI 1050

  Fly   281 ----SWKRNRRALAYSTV----------------------------------------------- 294
                |.:|:...|::|.:                                               
Yeast  1051 DLPASLRRSESQLSFSLLDISRSSTPPLANPTNSNANNIMRRKSLTENKSFSNDLLSSDAIAATN 1115

  Fly   295 ---------------------------------GTPDYIAPEVFLQTGY-GPACDWWSLGVIMYE 325
                                             |||||:|||.....|. ...|||||:|.|.:|
Yeast  1116 TNINSNNNISLSPAPSDLALFYPDDSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFE 1180

  Fly   326 MLMGYPPFCSDNPQDTYRKVMN----WRETLIFPPEIPISEEAKE-------TIINFCCEAD--R 377
            :|:|||||.::.|...::|:::    |       ||....||.:|       .:|......|  :
Yeast  1181 LLLGYPPFHAETPDAVFKKILSGVIQW-------PEFKNEEEEREFLTPEAKDLIEKLLVVDPAK 1238

  Fly   378 RLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFD 423
            |||: :|::::|..|:|:.|||:|:.:..|:....:.:.:||..||
Yeast  1239 RLGA-KGIQEIKDHPYFKNVDWDHVYDEEASFVPTIDNPEDTDYFD 1283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 133/500 (27%)
RIM15NP_116620.1 PKc_like 797..1260 CDD:419665 125/470 (27%)
S_TK_X 1255..>1298 CDD:214529 9/29 (31%)
REC_hyHK_CKI1_RcsC-like 1637..1746 CDD:381099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.