DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and ROCK1

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_005397.1 Gene:ROCK1 / 6093 HGNCID:10251 Length:1354 Species:Homo sapiens


Alignment Length:403 Identity:158/403 - (39%)
Similarity:233/403 - (57%) Gaps:60/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AQRQEKRLQH---AQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLR 125
            |.|:.|.:.:   ..|:| ..:::.||:..||:|.:|||||||||||:||:.|.|..|||||:|.
Human    45 ALRKNKNIDNFLSRYKDT-INKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLS 108

  Fly   126 KADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSE 190
            |.:|:::...|....|||::..|:..|||:::|:|||...||::||::||||::.|:...| :.|
Human   109 KFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYD-VPE 172

  Fly   191 EGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQ 255
            :..:||.:|..||:|:||.:||||||:||||:|||..|||||:|||.|..:.|.           
Human   173 KWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKE----------- 226

  Fly   256 AKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTG----YGPACDW 316
                      ..:.|.                    :.|||||||:|||....|    ||..|||
Human   227 ----------GMVRCD--------------------TAVGTPDYISPEVLKSQGGDGYYGRECDW 261

  Fly   317 WSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEIPISEEAKETIINFCCEADRRLGS 381
            ||:||.:||||:|..||.:|:...||.|:||.:.:|.||.:..||:|||..|..|..:.:.||| 
Human   262 WSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLG- 325

  Fly   382 QRGLEDLKSVPFFRGVD--WEHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQ---GG 441
            :.|:|::|...||:...  ||.:|:..|.:..::.|..||||||:..:...|..:.|||:   |.
Human   326 RNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGN 390

  Fly   442 EIAKDWVFINYTY 454
            ::.    |:.:||
Human   391 QLP----FVGFTY 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 5/23 (22%)
STKc_NDR_like 91..455 CDD:270750 151/373 (40%)
ROCK1NP_005397.1 STKc_ROCK1 2..406 CDD:270772 158/403 (39%)
S_TKc 76..338 CDD:214567 128/304 (42%)
Interaction with FHOD1. /evidence=ECO:0000269|PubMed:18694941 368..727 10/36 (28%)
SbcC <422..1027 CDD:223496
HR1_ROCK1 489..554 CDD:212029
SHROOM3 binding. /evidence=ECO:0000269|PubMed:22493320 707..946
Rho_Binding 949..1014 CDD:286056
RHOA binding 998..1010
Auto-inhibitory 1115..1354
PH_ROCK 1119..1225 CDD:269948
C1 1229..1275 CDD:237996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1320..1354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.