DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and cdc42bpaa

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_021322967.1 Gene:cdc42bpaa / 567912 ZFINID:ZDB-GENE-120727-12 Length:1757 Species:Danio rerio


Alignment Length:409 Identity:173/409 - (42%)
Similarity:240/409 - (58%) Gaps:56/409 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DESLSEAQRQEKR----LQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHV 118
            ||..:...|:||.    |:.|:..|.  ::|::||..||||.||||||||||||.:|:.|.:..|
Zfish    40 DECTNSPLRREKNVAEFLEWAKPFTS--KVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKSSDKV 102

  Fly   119 YAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLM 183
            :|||:|.|.:||::.:.|..|.||||||..|.||:..::|:|||...|||:|::..|||::|||.
Zfish   103 FAMKILNKWEMLKRAETACFREERDVLVNGDSQWITTLHYAFQDDNFLYLVMDYYVGGDLLTLLS 167

  Fly   184 K-KDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRT 247
            | :|.|.|:..:||::|..|||||:|:|.::||||||||:|:|..||::|:|||.|..|.:.   
Zfish   168 KFEDRLPEDMARFYLAEMVLAIDSVHQLHYVHRDIKPDNILIDVNGHIRLADFGSCLKLTED--- 229

  Fly   248 DFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVF--LQTG- 309
                           ||..|                    ::|   |||||||:||:.  ::.| 
Zfish   230 ---------------GTVQS--------------------SVA---VGTPDYISPEILQAMEDGK 256

  Fly   310 --YGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEI-PISEEAKETIINF 371
              |||.||||||||.|||||.|..||.:::..:||.|:||.:|...||.:: .:||.||:.|...
Zfish   257 GKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQMTDVSENAKDLIRRL 321

  Fly   372 CCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAP 436
            .|..:.||| |.|:||.|..|||.|:||::||...|....||.|..||||||...|......:.|
Zfish   322 ICCREHRLG-QNGIEDFKQHPFFSGIDWQNIRNCDAPYIPEVSSPSDTSNFDVDDDCLKNTETMP 385

  Fly   437 IPQGGEIAKDWV-FINYTY 454
            .|.....:...: |:.:||
Zfish   386 PPSHTAFSGHHLPFVGFTY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 8/30 (27%)
STKc_NDR_like 91..455 CDD:270750 162/372 (44%)
cdc42bpaaXP_021322967.1 PKc_like 4..412 CDD:328722 173/409 (42%)
SbcC <433..>926 CDD:223496
KELK 528..606 CDD:318090
C1_1 1009..1059 CDD:278556
PH_MRCK 1068..1203 CDD:269949
CNH 1229..1495 CDD:307087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.