DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and CDC42BPG

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_011543457.1 Gene:CDC42BPG / 55561 HGNCID:29829 Length:1569 Species:Homo sapiens


Alignment Length:381 Identity:159/381 - (41%)
Similarity:228/381 - (59%) Gaps:50/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLV 146
            ::|.|||..:|||.||||||||||||.:|:::|||.::|||:|.|.:||::.:.|..|.||||||
Human    60 KVKELRLQRDDFEILKVIGRGAFGEVTVVRQRDTGQIFAMKMLHKWEMLKRAETACFREERDVLV 124

  Fly   147 EADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMK-KDTLSEEGTQFYISETALAIDSIHKL 210
            :.|.:||..::|:|||...|||:|::..|||::|||.: :|.|..|..|||::|..|||.|:|:|
Human   125 KGDSRWVTTLHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMVLAIHSLHQL 189

  Fly   211 GFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDS 275
            |::|||:||||:|||..||::|:|||.|..|..:...|                 :|::      
Human   190 GYVHRDVKPDNVLLDVNGHIRLADFGSCLRLNTNGMVD-----------------SSVA------ 231

  Fly   276 KRRAESWKRNRRALAYSTVGTPDYIAPEVF--LQTG---YGPACDWWSLGVIMYEMLMGYPPFCS 335
                              |||||||:||:.  ::.|   |||.||||||||..||:|.|..||.:
Human   232 ------------------VGTPDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYA 278

  Fly   336 DNPQDTYRKVMNWRETLIFPPEIP-ISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDW 399
            ::..:||.|:||..:.|.|||::| :...|::.|....|..:.||| :.||:|.::.|||.||||
Human   279 ESLVETYGKIMNHEDHLQFPPDVPDVPASAQDLIRQLLCRQEERLG-RGGLDDFRNHPFFEGVDW 342

  Fly   400 EHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQGGEIAKDWV-FINYTY 454
            |.:....|....|:|...||||||...|......:.|.|..|..:...: |:.:||
Human   343 ERLASSTAPYIPELRGPMDTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTY 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 0/2 (0%)
STKc_NDR_like 91..455 CDD:270750 155/372 (42%)
CDC42BPGXP_011543457.1 STKc_DMPK_like 69..399 CDD:270748 155/372 (42%)
S_TKc 71..337 CDD:214567 131/307 (43%)
TPH 410..802 CDD:290579
DMPK_coil 744..801 CDD:117396
C1_1 897..>939 CDD:278556
PH_MRCK 956..1088 CDD:269949
CNH 1115..1378 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.