DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and aPKC

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster


Alignment Length:386 Identity:128/386 - (33%)
Similarity:199/386 - (51%) Gaps:73/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEA-DHQWV 153
            :.|||.::|||||::.:|.:|:.:.|..:|||||::||.:.:.|.:..|:.|:.|...| :|.::
  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677

  Fly   154 VKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIK 218
            |.::..||.|..|:.::||:.|||:|..:.::..|.||..:||.:|.:||::.:|:.|.|:||:|
  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLK 742

  Fly   219 PDNLLLDARGHLKLSDFGLC-TGLKKSHRTDFYRDLSQAKPSDFIGT-CASLSCSPMDSKRRAES 281
            .||:|||..||:||:|:|:| .|:               :|.|...| |                
  Fly   743 LDNVLLDHEGHIKLTDYGMCKEGI---------------RPGDTTSTFC---------------- 776

  Fly   282 WKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPF----CSDNP-QDT 341
                         |||:|||||:.....||.:.|||:|||::||||.|..||    .|:|| |:|
  Fly   777 -------------GTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNT 828

  Fly   342 --YRKVMNWRETLIFPPEIPISEEAKETIINFCCE--ADRRLGSQR--GLEDLKSVPFFRGVDWE 400
              |...:...:|:..|..  :|..|...:..|..:  || |||..|  ...|:.|.|||:.:|||
  Fly   829 EDYLFQVILEKTIRIPRS--LSVRAASVLKGFLNKNPAD-RLGCHRESAFMDIVSHPFFKNMDWE 890

  Fly   401 HIRERPAAIPVEVR--SIDDTSNF-DEFPDVSLEIPSAPIPQGGEIAKDWVFINYTYKRFE 458
            .:..:....|.:.|  |..|.:|| .||...::::    .|.     .|.|..|.....||
  Fly   891 LLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQL----TPD-----DDHVIDNIDQSEFE 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 126/380 (33%)
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 108/314 (34%)
STKc_aPKC 620..947 CDD:270740 125/379 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.