DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and dop

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster


Alignment Length:337 Identity:127/337 - (37%)
Similarity:187/337 - (55%) Gaps:36/337 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKM 156
            ||:.:|:|..||:|.|.||:.|.|...:|||.:.|.:::.:.||..|.||||:|..||:.:||.|
  Fly   834 DFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDILSFADNPFVVSM 898

  Fly   157 YYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDN 221
            |.||:...:|.|:||::.|||..|||.....|..:..:||.:||.||::.:|..|.:|||:||||
  Fly   899 YCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHSYGIVHRDLKPDN 963

  Fly   222 LLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNR 286
            ||:.|.||:||:||||......|..|:.|...                   :||:.|..|.|:  
  Fly   964 LLITALGHIKLTDFGLSKMGLMSLATNLYEGY-------------------IDSETRQFSDKQ-- 1007

  Fly   287 RALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMN---- 347
                  ..|||:||||||.|:.|||...||||:|:|:||.|:|..||..:..::.:...:|    
  Fly  1008 ------VYGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDIE 1066

  Fly   348 WRETLIFPPEIPISEEAKETIINFCCEADR-RLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPV 411
            |.::    .:.|:..|||:.|.....:..| |||:|.|..::|...:|.|:||..:..:.|....
  Fly  1067 WPDS----EDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQKAEFVP 1127

  Fly   412 EVRSIDDTSNFD 423
            ::...||||.||
  Fly  1128 QLSHDDDTSYFD 1139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 127/337 (38%)
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 118/311 (38%)
S_TKc 835..1110 CDD:214567 115/305 (38%)
PDZ_signaling 1506..1587 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.