DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and Lats1

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001128015.2 Gene:Lats1 / 308265 RGDID:1564085 Length:1130 Species:Rattus norvegicus


Alignment Length:449 Identity:188/449 - (41%)
Similarity:281/449 - (62%) Gaps:24/449 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KVTLENYYSNLVTQYGERKQRLAKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVED 92
            |..:|.:..|::..:.:|..|..:||.::....||:..:.:.|....|||:.|:||||.::....
  Rat   640 KFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSM 704

  Fly    93 FEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMY 157
            |..:|.:|.||||||.|.:|.||..:||.|.|||.|:|.:.|||||:||||:|.|||::|||::|
  Rat   705 FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLY 769

  Fly   158 YSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNL 222
            |||||..|||.:|:::||||||:||::.....|...:|||:|...|::|:||:|||||||||||:
  Rat   770 YSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNI 834

  Fly   223 LLDARGHLKLSDFGLCTGLKKSHRTDFYR--DLSQAKPSDFI---GTCASLSC----SPMDSKRR 278
            |:|..||:||:|||||||.:.:|.:.:|:  |..:....||.   |..::..|    .|::  ||
  Rat   835 LIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSSEWGDPSNCRCGDRLKPLE--RR 897

  Fly   279 AESWKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYR 343
            |.  ::::|.||:|.||||:||||||.|:|||...|||||:|||::|||:|.|||.:..|.:|..
  Rat   898 AA--RQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQM 960

  Fly   344 KVMNWRETLIFPPEIPISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDW-EHIRERPA 407
            ||:||:.:|..||:..:|.||.:.||..|...:.||| :.|.:::|:.|||:.:|: ..:|::.|
  Rat   961 KVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLG-KNGADEIKAHPFFKTIDFSSDLRQQSA 1024

  Fly   408 AIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQGGEIAKDW---------VFINYTYKRF 457
            :...::....||||||......|...........:....|         .|..:|::||
  Rat  1025 SYIPKITHPTDTSNFDPVDPDKLWSDGNEEENINDTLNGWYKNGKHPEHAFYEFTFRRF 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 16/56 (29%)
STKc_NDR_like 91..455 CDD:270750 168/382 (44%)
Lats1NP_001128015.2 UBA_like_SF 103..143 CDD:419673
PHA03247 <183..590 CDD:223021
STKc_LATS1 703..1084 CDD:270775 170/386 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.