DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and Cdc42bpg

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_038964401.1 Gene:Cdc42bpg / 293693 RGDID:1307260 Length:1558 Species:Rattus norvegicus


Alignment Length:446 Identity:170/446 - (38%)
Similarity:245/446 - (54%) Gaps:86/446 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KQRLAKLEAQLKDES-------------------LSEAQ-RQEKRLQHAQKETEYL--------R 82
            :|||..||..::.|:                   ||.|. |:|:.:      .::|        :
  Rat     2 EQRLRALEQLVRGEAGGSPGLDGLLDLLLGVHQELSSAPLRRERNV------AQFLSWAGPFVTK 60

  Fly    83 LKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVE 147
            :|.|||..:|||.||||||||||||.:|:::|:|.::|||:|.|.:||::.:.|..|.||||||:
  Rat    61 VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREERDVLVK 125

  Fly   148 ADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMK-KDTLSEEGTQFYISETALAIDSIHKLG 211
            .|.:||..::|:|||...|||:|::..|||::|||.: :|.|..|..|||::|..|||.|:|:||
  Rat   126 GDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMVLAIHSLHQLG 190

  Fly   212 FIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSK 276
            ::|||:||||:|||..||::|:|||.|..|..:...|                 :|::       
  Rat   191 YVHRDVKPDNILLDMNGHIRLADFGSCLRLNNNGMVD-----------------SSVA------- 231

  Fly   277 RRAESWKRNRRALAYSTVGTPDYIAPEVF--LQTG---YGPACDWWSLGVIMYEMLMGYPPFCSD 336
                             |||||||:||:.  ::.|   |||.||||||||..||:|.|..||.::
  Rat   232 -----------------VGTPDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAE 279

  Fly   337 NPQDTYRKVMNWRETLIFPPEI-PISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWE 400
            :..:||.|:||..:.|.||.:: .:...|:..|....|..:.||| :.||:|.:|.|||.|||||
  Rat   280 SLVETYGKIMNHEDHLQFPSDVDDVPASAQALIRQLLCRQEERLG-RGGLDDFRSHPFFEGVDWE 343

  Fly   401 HIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSA--PIPQGGEIAKDWVFINYTY 454
            .:....|....|:|...|||||| ..|.:|..|..  |...|........|:.:||
  Rat   344 RLATSTAPYIPELRGPVDTSNFD-VDDDTLNRPETLPPSSHGAFSGHHLPFVGFTY 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 12/66 (18%)
STKc_NDR_like 91..455 CDD:270750 154/373 (41%)
Cdc42bpgXP_038964401.1 STKc_DMPK_like 69..399 CDD:270748 154/373 (41%)
SMC_prok_B <450..809 CDD:274008
C1_MRCKgamma 885..936 CDD:410416
PH_MRCK 944..1076 CDD:269949
CNH 1103..1366 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.