DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and Cdc42bpb

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_006515826.1 Gene:Cdc42bpb / 217866 MGIID:2136459 Length:1730 Species:Mus musculus


Alignment Length:448 Identity:184/448 - (41%)
Similarity:251/448 - (56%) Gaps:87/448 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KQRLAKLEAQL------KDESLS-----------------EAQRQEKR----LQHAQKETEYLRL 83
            |.||.|||..|      .|.:||                 .|.|::|.    |:.|:..|:.  :
Mouse     4 KVRLKKLEQLLLDGPWRNDSALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQL--V 66

  Fly    84 KRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEA 148
            |.::|..||||.:|||||||||||.:|:.|:|..:||||:|.|.:||::.:.|..|.||||||..
Mouse    67 KDMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNG 131

  Fly   149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMK-KDTLSEEGTQFYISETALAIDSIHKLGF 212
            |.||:..::|:|||...|||:|::..|||::|||.| :|.|.|:..:|||.|..|||||||:|.:
Mouse   132 DCQWITALHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHY 196

  Fly   213 IHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKR 277
            :||||||||:|||..||::|:|||                                ||..|:...
Mouse   197 VHRDIKPDNVLLDVNGHIRLADFG--------------------------------SCLKMNDDG 229

  Fly   278 RAESWKRNRRALAYSTVGTPDYIAPEVF--LQTG---YGPACDWWSLGVIMYEMLMGYPPFCSDN 337
            ..:|      ::|   |||||||:||:.  ::.|   |||.||||||||.|||||.|..||.:::
Mouse   230 TVQS------SVA---VGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAES 285

  Fly   338 PQDTYRKVMNWRETLIFPPEI-PISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWEH 401
            ..:||.|:||..|...||..: .:|||||:.|....|..:|||| |.|:||.|...||.|::||:
Mouse   286 LVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLG-QNGIEDFKKHAFFEGLNWEN 349

  Fly   402 IRERPAAIPVEVRSIDDTSNFDEFPDV--SLEIPSAPIPQGGEIAKDWV---FINYTY 454
            ||...|....:|.|..||||||...|:  ::||    :|.|.......:   ||.:|:
Mouse   350 IRNLEAPYIPDVSSPSDTSNFDVDDDMLRNIEI----LPPGSHTGFSGLHLPFIGFTF 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 16/65 (25%)
STKc_NDR_like 91..455 CDD:270750 166/376 (44%)
Cdc42bpbXP_006515826.1 STKc_MRCK_beta 3..411 CDD:270774 184/448 (41%)
SbcC 429..>933 CDD:223496
KELK 527..606 CDD:374120
C1 1044..1093 CDD:237996
PH_MRCK 1103..1237 CDD:269949
CNH 1263..1529 CDD:366300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.