DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and LOC108182331

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_017209952.1 Gene:LOC108182331 / 108182331 -ID:- Length:93 Species:Danio rerio


Alignment Length:94 Identity:43/94 - (45%)
Similarity:62/94 - (65%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 MKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKK 185
            ||.|.|.:|:::...|....|||::..:...|:|::..:|||...|||:|||:||||::||....
Zfish     1 MKQLSKFEMVKRSDSAFFWEERDIMAFSQSPWIVQLCCAFQDEKYLYLVMEFMPGGDLVTLTSNY 65

  Fly   186 DTLSEEGTQFYISETALAIDSIHKLGFIH 214
            | :.||..|||.:|..||:|:||.|||||
Zfish    66 D-IPEEWAQFYTAEVVLALDAIHSLGFIH 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 43/94 (46%)
LOC108182331XP_017209952.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.