DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and LOC100535131

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_017210028.2 Gene:LOC100535131 / 100535131 -ID:- Length:188 Species:Danio rerio


Alignment Length:217 Identity:93/217 - (42%)
Similarity:125/217 - (57%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLL 223
            :|||...|||:|||:||||::||....| :.||..|||.:|..||:|:||.||||||||||||:|
Zfish    10 AFQDEKYLYLVMEFMPGGDLVTLTSNYD-IPEEWAQFYTAEVVLALDAIHSLGFIHRDIKPDNML 73

  Fly   224 LDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRA 288
            ||..||.||:|||.||.:..:                     ..:||.                 
Zfish    74 LDRNGHFKLADFGTCTKMDST---------------------GMVSCD----------------- 100

  Fly   289 LAYSTVGTPDYIAPEVFLQTG----YGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWR 349
               :.|||||||:|||.:..|    ||..|||||:||.:||:|:|..||.|::...||.|:|:.:
Zfish   101 ---AAVGTPDYISPEVLMSQGGTGYYGRECDWWSVGVFIYELLVGDTPFYSESLVGTYGKIMDHK 162

  Fly   350 ETLIFPPEIPISEEAKETIINF 371
            .:|.||.:|.:|::||:.|..|
Zfish   163 NSLTFPDDIEMSKDAKDLICAF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 93/217 (43%)
LOC100535131XP_017210028.2 PKc_like <5..>188 CDD:328722 93/217 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.