DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trc and cdc42bpa

DIOPT Version :9

Sequence 1:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_031758436.1 Gene:cdc42bpa / 100497067 XenbaseID:XB-GENE-6037508 Length:1829 Species:Xenopus tropicalis


Alignment Length:444 Identity:178/444 - (40%)
Similarity:247/444 - (55%) Gaps:87/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LKDESLSEAQRQEKRL-QHAQKETEY-LRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHV 118
            |.||..:...|::|.: .:.|....: |::|::||..||||.||||||||||||.:|:.|:...|
 Frog    36 LYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKV 100

  Fly   119 YAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLM 183
            :|||:|.|.:||::.:.|..|.||||||..|.||:..::|:|||..||||:|::..|||::|||.
 Frog   101 FAMKILNKWEMLKRAETACFREERDVLVNGDSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLS 165

  Fly   184 K-KDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRT 247
            | :|.|.|:.::||::|..|||||:|:|.::||||||||:|||..||::|:|||.|..|.:.   
 Frog   166 KFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMED--- 227

  Fly   248 DFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVF--LQTG- 309
                           ||..|                    ::|   |||||||:||:.  ::.| 
 Frog   228 ---------------GTVQS--------------------SVA---VGTPDYISPEILQAMEDGK 254

  Fly   310 --YGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEI-PISEEAKETIINF 371
              |||.||||||||.|||||.|..||.:::..:||.|:||.:|...||.:: .:||.||:.|...
 Frog   255 GKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRL 319

  Fly   372 CCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFDE------------ 424
            .|..:.||| |.|:||.|:.|||.|:||::||...|....||.|..||||||.            
 Frog   320 ICSREHRLG-QNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCTGAS 383

  Fly   425 ----------FPDVSLEIPSAPIPQG--------------GEIAKDWVFINYTY 454
                      .||:..|..:.|.|.|              |.......|:.:||
 Frog   384 VPSHPYSIDLAPDLQAEGLTEPSPNGQHPVAETMPPPTHTGFSGHHLPFVGFTY 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trcNP_001262071.1 OmpH 16..>85 CDD:214922 7/30 (23%)
STKc_NDR_like 91..455 CDD:270750 168/407 (41%)
cdc42bpaXP_031758436.1 PKc_like 4..445 CDD:419665 178/444 (40%)
SbcC <475..965 CDD:223496
KELK 563..641 CDD:406277
C1_MRCKalpha 1081..1140 CDD:410414
PH_MRCK 1142..1276 CDD:269949
CNH 1302..1566 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.