Sequence 1: | NP_001262069.1 | Gene: | Deaf1 / 40164 | FlyBaseID: | FBgn0013799 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009295182.1 | Gene: | samd11 / 569122 | ZFINID: | ZDB-GENE-060428-2 | Length: | 874 | Species: | Danio rerio |
Alignment Length: | 347 | Identity: | 78/347 - (22%) |
---|---|---|---|
Similarity: | 128/347 - (36%) | Gaps: | 119/347 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 222 QIRCKTTCAELYRSKLGSGGRGRCVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLID 286
Fly 287 EGTLTPHATNCSCTVC-----------------------------------CDDEAGESASGPVR 316
Fly 317 LFTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSGSG---ANNCVDVTAAVAAATA 378
Fly 379 SVVDENNMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMGNTYERETFVVNINDGSSIAVLDT 443
Fly 444 SQSMKNIEHVYCTMVKATND----------FKRMLNDM--------------------------- 471
Fly 472 -----KQSFERRIEVLQKERDA 488 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Deaf1 | NP_001262069.1 | SAND | 219..291 | CDD:128554 | 31/68 (46%) |
zf-MYND | 521..557 | CDD:280009 | |||
samd11 | XP_009295182.1 | SAND | 93..165 | CDD:279658 | 31/67 (46%) |
SAM_Samd7,11 | 734..801 | CDD:188978 | |||
SAM | 735..791 | CDD:197735 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |