DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and samd11

DIOPT Version :9

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_009295182.1 Gene:samd11 / 569122 ZFINID:ZDB-GENE-060428-2 Length:874 Species:Danio rerio


Alignment Length:347 Identity:78/347 - (22%)
Similarity:128/347 - (36%) Gaps:119/347 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 QIRCKTTCAELYRSKLGSGGRGRCVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLID 286
            ::.|....|.||.:||..|.:|..:||:.:|.||:||:.|.||.::|||||||::.||||::|:.
Zfish    97 EVECGENKALLYINKLCQGSKGPSIKYRTEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMS 161

  Fly   287 EGTLTPHATNCSCTVC-----------------------------------CDDEAGESASGPVR 316
            :|.|..|...|.|..|                                   .|.|..|.|||.  
Zfish   162 KGILQVHPPICDCPGCRISSPVNRGRLAEKRTIPLPPTRVPKKELASVFSSDDSEGSERASGD-- 224

  Fly   317 LFTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSGSG---ANNCVDVTAAVAAATA 378
             ....|:.:.|.|.:         |.:..|:.:...:|.::|...|   ..:|.|::.| :|.|.
Zfish   225 -HADIKQEELNFTIM---------RKSRDSDLSTIISNLHHTRQHGMPEGQSCSDLSLA-SAHTD 278

  Fly   379 SVVDENNMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMGNTYERETFVVNINDGSSIAVLDT 443
            .::.:...:                  |.::|:|....|:...:       |:..:.|....|:.
Zfish   279 DILGKRRAY------------------SPNSSSECPSDSKKSRS-------VSPKENSHTPALEP 318

  Fly   444 SQSMKNIEHVYCTMVKATND----------FKRMLNDM--------------------------- 471
            ...|...|| |..|:.|.|:          ..::.|:|                           
Zfish   319 GSHMTPEEH-YRRMMSALNEHGSYEEQQQRLYQLANNMGIPSHELLHVRQEAMVAVRNPGGMEAH 382

  Fly   472 -----KQSFERRIEVLQKERDA 488
                 ..|.:||.:.|.:.|||
Zfish   383 VPSAGSSSSQRRKQGLPQHRDA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 31/68 (46%)
zf-MYND 521..557 CDD:280009
samd11XP_009295182.1 SAND 93..165 CDD:279658 31/67 (46%)
SAM_Samd7,11 734..801 CDD:188978
SAM 735..791 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.